PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast05G039700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family B3
Protein Properties Length: 364aa    MW: 40833.2 Da    PI: 10.1131
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast05G039700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3314.4e-102554299
                        TS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
                  B3 42 sgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99
                        sg +W+v+l     +++ +++ GWk+Fv ++ +     ++F+++g+s+f   v +f++
  Brast05G039700.1.p  2 SGHTWNVEL--ASDKDGWFFGLGWKRFVIDHSIGISQLLTFRYEGNSQF--SVVIFSA 55
                        89*******..88888899**************************9999..8877765 PP

2B351.71.6e-16257349399
                         EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
                  B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                          ++++ +v +   +++p kf+++h   ++++k l+l d++ + W+v++ y+ + ++  ++ GW+eF   n+L+e D++vF+l +  + e +
  Brast05G039700.1.p 257 EIMKRTNVYAGFFMIIPSKFVKDHL--PTNDKILKLVDPQAKIWDVQYVYSSQHSSGAFSPGWSEFSLFNHLEEFDVCVFELLS--KDEIK 343
                         5677788889999********9994..456779****************977777777999********************876..55568 PP

                         EEEE-S CS
                  B3  94 vkvfrk 99 
                         v+++r+
  Brast05G039700.1.p 344 VHIYRA 349
                         999886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086312.534156IPR003340B3 DNA binding domain
PfamPF023627.4E-8255IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.2E-12257IPR015300DNA-binding pseudobarrel domain
CDDcd100171.00E-8254No hitNo description
SuperFamilySSF1019369.42E-12255IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.5E-23247350IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.2E-22248350IPR015300DNA-binding pseudobarrel domain
CDDcd100172.78E-22253348No hitNo description
SMARTSM010192.4E-11255350IPR003340B3 DNA binding domain
PROSITE profilePS5086313.211255350IPR003340B3 DNA binding domain
PfamPF023621.2E-14257349IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
QSGHTWNVEL ASDKDGWFFG LGWKRFVIDH SIGISQLLTF RYEGNSQFSV VIFSATGSEM  60
TSAFHAKPHK NLGATLATDG GETELLAGTK MNSNKTSEVV PLKEGNTATK KRVRETDANA  120
SSFKKSSVVS EKCNKKLPEA SVATYRAAES IKMNNTTDPL ERSKRINMNK NTTDPLERSK  180
VKLEESDGTG TSRKRVRKMD ASESTLKKCS LVSQKGSVTS QRQPSVTSQR PPVTEEQKKY  240
ARQNAEKFKS KRPFTFEIMK RTNVYAGFFM IIPSKFVKDH LPTNDKILKL VDPQAKIWDV  300
QYVYSSQHSS GAFSPGWSEF SLFNHLEEFD VCVFELLSKD EIKVHIYRAN PELFLFLHGS  360
SSK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_B6e-1422535019143B3 domain-containing transcription factor VRN
4i1k_A6e-1422535019143B3 domain-containing transcription factor VRN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010237857.14e-95PREDICTED: B3 domain-containing protein Os11g0197600-like isoform X2
TrEMBLA0A0Q3HLD64e-94A0A0Q3HLD6_BRADI; Uncharacterized protein
TrEMBLI1IMS65e-93I1IMS6_BRADI; Uncharacterized protein
STRINGBRADI4G23270.12e-92(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44613766
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49480.13e-14related to vernalization1 1